Anti-SMAD (SMAD1-5)

Anti-SMAD (SMAD1-5)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32238 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SMADs are proteins that modulate the... more
Product information "Anti-SMAD (SMAD1-5)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4. Protein function: Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. [The UniProt Consortium]
Keywords: Anti-BSP1, Anti-SMAD1, Anti-JV4-1, Anti-Smad1, Anti-BSP-1, Anti-hSMAD1, Anti-SMAD 1, Anti-MAD homolog 1, Anti-SMAD family member 1, Anti-Mad-related protein 1, Anti-Mothers against DPP homolog 1, Anti-Mothers against decapentaplegic homolog 1, SMAD Antibo
Supplier: NSJ Bioreagents
Supplier-Nr: R32238

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SMAD (SMAD1-5)"
Write a review
or to review a product.
Viewed