Anti-SLC34A2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4878 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium-dependent phosphate transport... more
Product information "Anti-SLC34A2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene. Protein function: Involved in actively transporting phosphate into cells via Na(+) cotransport. [The UniProt Consortium]
Keywords: Anti-NaPi3b, Anti-NaPi-2b, Anti-SLC34A2, Anti-Na(+)/Pi cotransporter 2B, Anti-Solute carrier family 34 member 2, Anti-Sodium/phosphate cotransporter 2B, Anti-Sodium-phosphate transport protein 2B, Anti-Na(+)-dependent phosphate cotransporter 2B, SLC34A2 A
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4878

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SLC34A2"
Write a review
or to review a product.
Viewed