Anti-SLC34A2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-RQ4878	100 µg		-	-	3 - 10 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium-dependent phosphate transport... more

Close menu

Product information "Anti-SLC34A2"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene. Protein function: Involved in actively transporting phosphate into cells via Na(+) cotransport. [The UniProt Consortium]

Keywords:	Anti-NaPi3b, Anti-NaPi-2b, Anti-SLC34A2, Anti-Na(+)/Pi cotransporter 2B, Anti-Solute carrier family 34 member 2, Anti-Sodium/phosphate cotransporter 2B, Anti-Sodium-phosphate transport protein 2B, Anti-Na(+)-dependent phosphate cotransporter 2B, SLC34A2 A
Supplier:	NSJ Bioreagents
Supplier-Nr:	RQ4878

Properties

Application:	WB, IHC (paraffin), IF
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein
Format:	Purified