Anti-SLC25A20

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59640.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Mediates the transport of acylcarnitines of different length across the... more

Close menu

Product information "Anti-SLC25A20"

Protein function: Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. [The UniProt Consortium]

Keywords:	Anti-CAC, Anti-SLC25A20, Anti-Solute carrier family 25 member 20, Anti-Carnitine/acylcarnitine translocase, Anti-Mitochondrial carnitine/acylcarnitine carrier protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59640

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, sheep, zebrafish)
Immunogen:	Synthetic peptide around the C-terminal region of Human SLC25A20. (within the following region: GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL)
MW:	33 kD
Format:	Affinity Purified