Anti-SLC10A1 / NTCP

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31795 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Na+-taurocholate cotransporting... more
Product information "Anti-SLC10A1 / NTCP"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity. Protein function: As a major transporter of conjugated bile salts from plasma into the hepatocyte, it plays a key role in the enterohepatic circulation of bile salts necessary for the solubilization and absorption of dietary fat and fat-soluble vitamins (PubMed:10209268). It is strictly dependent on the extracellular presence of sodium (PubMed:10209268, PubMed:34060352). It exhibits broad substrate specificity and transports various bile acids, such as taurocholate, cholate, as well as non-bile acid organic compounds, such as estrone sulfate (PubMed:10209268, PubMed:34060352). Works collaboratively with the ileal transporter (NTCP2), the organic solute transporter (OST), and the bile salt export pump (BSEP), to ensure efficacious biological recycling of bile acids during enterohepatic circulation. [The UniProt Consortium]
Keywords: Anti-NTCP, Anti-Ntcp, Anti-SLC10A1, Anti-Slc10a1, Anti-Na(+)/bile acid cotransporter, Anti-Solute carrier family 10 member 1, Anti-Na(+)/taurocholate transport protein, Anti-Hepatic sodium/bile acid cotransporter, SLC10A1 Antibody / NTCP
Supplier: NSJ Bioreagents
Supplier-Nr: R31795

Properties

Application: WB, IHC (paraffin), (IF), FC, IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SLC10A1 / NTCP"
Write a review
or to review a product.
Viewed