Anti-SI / Sucrase Isomaltase

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4659 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is mapped to 3q26.1. It encodes... more
Product information "Anti-SI / Sucrase Isomaltase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency. Protein function: Plays an important role in the final stage of carbohydrate digestion. Isomaltase activity is specific for both alpha-1,4- and alpha-1,6-oligosaccharides. [The UniProt Consortium]
Keywords: Anti-SI, EC=3.2.1.48, EC=3.2.1.10, SI Antibody / Sucrase Isomaltase
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4659

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SI / Sucrase Isomaltase"
Write a review
or to review a product.
Viewed