Anti-SI / Sucrase isomaltase

Anti-SI / Sucrase isomaltase
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG42958.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Plays an important role in the final stage of carbohydrate digestion.... more
Product information "Anti-SI / Sucrase isomaltase"
Protein function: Plays an important role in the final stage of carbohydrate digestion. Isomaltase activity is specific for both alpha-1,4- and alpha-1,6-oligosaccharides. [The UniProt Consortium]
Keywords: Anti-SI, Anti-Sucrase, Anti-Isomaltase, Anti-Sucrase-isomaltase, intestinal
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG42958

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human SI / Sucrase isomaltase. (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID)
MW: 209 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SI / Sucrase isomaltase"
Write a review
or to review a product.
Viewed