Anti-SFTPA1/2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32279 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SFTPA1/2 is also known as SP-A. SFTPA1... more
Product information "Anti-SFTPA1/2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. Protein function: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air- liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. [The UniProt Consortium]
Keywords: Anti-PSPA, Anti-SP-A, Anti-SP-A2, Anti-PSP-A, Anti-SFTPA2, Anti-COLEC5, Anti-Collectin-5, Anti-Alveolar proteinosis protein, Anti-Pulmonary surfactant-associated protein A2, Anti-35 kDa pulmonary surfactant-associated protein, SFTPA1/2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32279

Properties

Application: WB, IHC (paraffin), (IF), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SFTPA1/2"
Write a review
or to review a product.
Viewed