Anti-SFTPA1 + SFTPA2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59549.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: In presence of calcium ions, it binds to surfactant phospholipids and... more

Close menu

Product information "Anti-SFTPA1 + SFTPA2"

Protein function: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages. [The UniProt Consortium]

Keywords:	Anti-SP-A, Anti-PSPA, Anti-SP-A1, Anti-PSP-A, Anti-COLEC4, Anti-SFTPA1, Anti-Collectin-4, Anti-Alveolar proteinosis protein, Anti-Pulmonary surfactant-associated protein A1, Anti-35 kDa pulmonary surfactant-associated protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59549

Properties

Application:	IHC (frozen), IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 206-237 of Human SFTPA1/2. (VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN)
MW:	26.2 kD
Format:	Antigen Affinity Purified