Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| 133181.200 | 200 µl | - | - |
5 - 10 business days* |
866.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Serpin B8 is a 42-45kD, cytoplasmic and secreted member of the ovalbumin (clade B)-subfamily,... more
Product information "Anti-SERPINB8 (Serine/Cysteine Proteinase Inhibitor, Clade B, Member 8, NK10, PI8)"
Serpin B8 is a 42-45kD, cytoplasmic and secreted member of the ovalbumin (clade B)-subfamily, Serpin superfamily of protease inhibitors. It is produced by multiple cell types and shows inhibitory activity towards furin and possibly other proteinases such as chymotrypsin. Mouse Serpin B8 is 374aa in length. Although it has no signal sequence, it is likely to be released by platelets. The active inhibitory site lies between Arg336 and Arg342. One potential isoform shows a 4aa substitution for the C-terminal 133aa. Full length mouse Serpin B8 shares 78% and 91% aa identity with human and rat Serpin B8, respectively. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
| Supplier: | United States Biological |
| Supplier-Nr: | 133181 |
Properties
| Application: | ELISA, WB |
| Antibody Type: | Monoclonal |
| Clone: | 1D10 |
| Conjugate: | No |
| Host: | Mouse |
| Species reactivity: | human |
| Format: | Ascites |
Database Information
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed