Anti-SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1,

Anti-SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
133118.100 100 µl - -

3 - 19 business days*

943.00€
 
Applications:|Suitable for use in Western Blot and Immunoprecipitation. Other applications not... more
Product information "Anti-SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1,"
Applications:, Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 133118

Properties

Application: IP, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Format: Serum

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1,"
Write a review
or to review a product.
Viewed