Anti-SCTR

Anti-SCTR
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32564 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human secretin receptor (gene name SCTR)... more
Product information "Anti-SCTR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization. Protein function: Receptor for secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:7612008, PubMed:25332973). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Upon binding to secretin, regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas. In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non- sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation. Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation. Also able to stimulate lipolysis in white adipocytes. Also plays an important role in cellular osmoregulation by regulating renal water reabsorption. Also plays a role in the central nervous system: required for synaptic plasticity. [The UniProt Consortium]
Keywords: Anti-SCTR, Anti-SCT-R, Anti-Secretin receptor, SCTR Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32564

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SCTR"
Write a review
or to review a product.
Viewed