Anti-SAFB / Scaffold attachment factor B1

Anti-SAFB / Scaffold attachment factor B1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32563 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Scaffold attachment factor B, also known... more
Product information "Anti-SAFB / Scaffold attachment factor B1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Binds to scaffold/matrix attachment region (S/MAR) DNA and forms a molecular assembly point to allow the formation of a 'transcriptosomal' complex (consisting of SR proteins and RNA polymerase II) coupling transcription and RNA processing. Can function as an estrogen receptor corepressor and can also bind to the HSP27 promoter and decrease its transcription. When associated with RBMX, binds to and stimulates transcription from the SREBF1 promoter. Can inhibit cell proliferation. [The UniProt Consortium]
Keywords: Anti-HAP, Anti-SAFB, Anti-SAF-B, Anti-SAF-B1, Anti-Scaffold attachment factor B1, Anti-HSP27 ERE-TATA-binding protein, Anti-HSP27 estrogen response element-TATA box-binding protein, SAFB Antibody / Scaffold attachment factor B1
Supplier: NSJ Bioreagents
Supplier-Nr: R32563

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein
Format: Purified

Database Information

UniProt ID : Q15424 | Matching products
Gene ID : GeneID 6294 | Matching products

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SAFB / Scaffold attachment factor B1"
Write a review
or to review a product.
Viewed