Anti-SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBL

Anti-SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBL
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132948.100 100 µg - -

5 - 10 business days*

850.00€
 
The ubiquitin-like protein SUMO-1 is conjugated to a variety of proteins including Ran... more
Product information "Anti-SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBL"
The ubiquitin-like protein SUMO-1 is conjugated to a variety of proteins including Ran GTPase-activating protein 1 (RanGAP1), IkappaB alpha, and PML. SUMO-1-modified proteins display altered subcellular targeting and/or stability. SAE1 is capable of catalyzing the ATP-dependent formation of a thioester linkage between SUMO-1 and SAE2. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 132948

Properties

Application: ELISA, IF, IHC, WB
Antibody Type: Monoclonal
Clone: 1G4-1G5
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBL"
Write a review
or to review a product.
Viewed