Anti-RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid

Retinoid X receptor G (RXRG or RXR gamma) is a nuclear receptor that mediates the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. RXRs as a whole exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulate their transcription.HeLa cell lysate, Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.