Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4608 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Relaxin/insulin-like family peptide... more
Product information "Anti-RXFP2 / Relaxin Receptor 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Protein function: Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3). [The UniProt Consortium]
| Keywords: | Anti-RXFP2, Anti-GPR106, Anti-Relaxin receptor 2, Anti-G-protein coupled receptor 106, Anti-Relaxin family peptide receptor 2, Anti-G-protein coupled receptor affecting testicular descent, Anti-Leucine-rich repeat-containing G-protein coupled receptor 8, |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4608 |
Properties
| Application: | WB, FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ |
| Format: | Purified |
Database Information
| KEGG ID : | K04307 | Matching products |
| UniProt ID : | Q8WXD0 | Matching products |
| Gene ID : | GeneID 122042 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed