Anti-RXFP2 / Relaxin Receptor 2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-RQ4608	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Relaxin/insulin-like family peptide... more

Close menu

Product information "Anti-RXFP2 / Relaxin Receptor 2"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Protein function: Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3). [The UniProt Consortium]

Keywords:	Anti-RXFP2, Anti-GPR106, Anti-Relaxin receptor 2, Anti-G-protein coupled receptor 106, Anti-Relaxin family peptide receptor 2, Anti-G-protein coupled receptor affecting testicular descent, Anti-Leucine-rich repeat-containing G-protein coupled receptor 8,
Supplier:	NSJ Bioreagents
Supplier-Nr:	RQ4608

Properties

Application:	WB, FC
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ
Format:	Purified