Anti-RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Prot

Anti-RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Prot
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132893.100 100 µg - -

3 - 19 business days*

850.00€
 
Transcription regulator that excerts its function by binding to histone deacetylases and... more
Product information "Anti-RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Prot"
Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 132893

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 5A12
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Prot"
Write a review
or to review a product.
Viewed