Anti-RRM2

Anti-RRM2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32063 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ribonucleoside-diphosphate reductase... more
Product information "Anti-RRM2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. Protein function: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. [The UniProt Consortium]
Keywords: Anti-RR2, Anti-RRM2, EC=1.17.4.1, Anti-Ribonucleotide reductase small chain, Anti-Ribonucleotide reductase small subunit, Anti-Ribonucleoside-diphosphate reductase subunit M2, RRM2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32063

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RRM2"
Write a review
or to review a product.
Viewed