Anti-RRM2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59132.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis... more
Product information "Anti-RRM2"
Protein function: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. [The UniProt Consortium]
Keywords: Anti-RR2, Anti-RRM2, EC=1.17.4.1, Anti-Ribonucleotide reductase small chain, Anti-Ribonucleotide reductase small subunit, Anti-Ribonucleoside-diphosphate reductase subunit M2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59132

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 1-33 of Human RRM2. (MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT)
MW: 45 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RRM2"
Write a review
or to review a product.
Viewed