Anti-RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1)

Anti-RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
251309.100 100 µg - -

5 - 10 business days*

850.00€
 
This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate... more
Product information "Anti-RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1)"
This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeq, Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 251309

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2G6
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: RRM1 (NP_001024.1, 593aa-792aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1)"
Write a review
or to review a product.
Viewed