Anti-RPS2 (40S Ribosomal Protein S2, 40S Ribosomal Protein S4, Protein LLRep3, RPS4, MGC102851, MGC1

Citrullinated by PADI4 in the Arg/Gly-rich region. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.