Anti-RPL13 (60S Ribosomal Protein L13, Breast Basic Conserved Protein 1, BBC1, OK/SW-cl.46, FLJ27453

Anti-RPL13 (60S Ribosomal Protein L13, Breast Basic Conserved Protein 1, BBC1, OK/SW-cl.46, FLJ27453
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132772.100 100 µg - -

5 - 10 business days*

850.00€
 
Higher levels of expression in benign breast lesions than in carcinomas.||Applications:|Suitable... more
Product information "Anti-RPL13 (60S Ribosomal Protein L13, Breast Basic Conserved Protein 1, BBC1, OK/SW-cl.46, FLJ27453"
Higher levels of expression in benign breast lesions than in carcinomas. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: ANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 132772

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 3F6
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RPL13 (60S Ribosomal Protein L13, Breast Basic Conserved Protein 1, BBC1, OK/SW-cl.46, FLJ27453"
Write a review
or to review a product.
Viewed