Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4378 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PEBP1 (Phosphatidylethanolamine-binding... more
Product information "Anti-RKIP / PEBP1 / PBP"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004). RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons. Protein function: Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation. [The UniProt Consortium]
| Keywords: | Anti-PBP, Anti-PEBP1, RKIP Antibody / PEBP1 / PBP |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4378 |
Properties
| Application: | WB, IHC (paraffin), FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
| Immunogen: | Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ |
| Format: | Adhesion & Structure |
Database Information
| KEGG ID : | K06910 | Matching products |
| UniProt ID : | P30086 | Matching products |
| Gene ID : | GeneID 5037 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed