Anti-RhoB

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG42694.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not... more
Product information "Anti-RhoB"
Protein function: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells. [The UniProt Consortium]
Keywords: Anti-h6, Anti-ARH6, Anti-RHOB, Anti-Rho cDNA clone 6, Anti-Rho-related GTP-binding protein RhoB
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG42694

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, monkey
Immunogen: Synthetic peptide corresponding to a sequence of Human RhoB. (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE)
MW: 22 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RhoB"
Write a review
or to review a product.
Viewed