Anti-RHOA (Transforming Protein RhoA, Rho cDNA Clone 12, h12, ARH12, ARHA, RHO12)

Anti-RHOA (Transforming Protein RhoA, Rho cDNA Clone 12, h12, ARH12, ARHA, RHO12)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132553.100 100 µg - -

3 - 19 business days*

761.00€
 
RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of... more
Product information "Anti-RHOA (Transforming Protein RhoA, Rho cDNA Clone 12, h12, ARH12, ARHA, RHO12)"
RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 132553

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human RHOA, aa1-193 (AAH01360.1).
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RHOA (Transforming Protein RhoA, Rho cDNA Clone 12, h12, ARH12, ARHA, RHO12)"
Write a review
or to review a product.
Viewed