Anti-RENT1 / hUPF1, clone 11E7.

Anti-RENT1 / hUPF1, clone 11E7.
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5658 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regulator of nonsense transcripts 1 is a... more
Product information "Anti-RENT1 / hUPF1, clone 11E7."
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants. Protein function: RNA-dependent helicase and ATPase required for nonsense- mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation, its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S, the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD. Essential for embryonic viability. Together with UPF2 and dependent on TDRD6, mediates the degradation of mRNA hardoring long 3'UTR by inducing the NMD machinery. [The UniProt Consortium]
Keywords: Anti-UPF1, Anti-NORF1, Anti-hUpf1, Anti-KIAA0221, EC=3.6.4.-, Anti-ATP-dependent helicase RENT1, Anti-Nonsense mRNA reducing factor 1, Anti-Up-frameshift suppressor 1 homolog, Anti-Regulator of nonsense transcripts 1, RENT1 / hUPF1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5658

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Monoclonal
Clone: 11E7.
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RENT1 / hUPF1, clone 11E7."
Write a review
or to review a product.
Viewed