Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used

Anti-REG1 alpha

Arigo
Anti-REG1 alpha
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41304.50 50 µl - -

6 - 14 business days*

584.00€
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
 
Description Product Citations Certificate of Analysis Reviews 0
Description
Protein function: Might act as an inhibitor of spontaneous calcium carbonate precipitation. May... more
Close menu
Product information "Anti-REG1 alpha"
Protein function: Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration. [The UniProt Consortium]
Keywords: Anti-PTP, Anti-PSP, Anti-REG, Anti-PSPS, Anti-ICRF, Anti-REG1A, Anti-REG-1-alpha, Anti-Lithostathine-1-alpha, Anti-Pancreatic stone protein, Anti-Pancreatic thread protein, Anti-Regenerating protein I alpha, Anti-Islet cells regeneration factor
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41304

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide located within the following region: SLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
MW: 19 kD
Format: Affinity Purified

Database Information

UniProt ID : P05451 | Matching products
Gene ID : GeneID 5967 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Product Citations
Information about the product reference will follow. more
Close menu
Certificate of Analysis
You will get a certificate here
Go back
or to request a certificate of analysis.
Reviews 0
Read, write and discuss reviews... more
Close menu
Customer review for "Anti-REG1 alpha"
Write a review
or to review a product.
Similar products
Similar products
Anti-REG1A Anti-REG1A
754.00€ *
Viewed
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure