Anti-Recoverin

Anti-Recoverin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41303.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Acts as a calcium sensor and regulates phototransduction of cone and rod... more
Product information "Anti-Recoverin"
Protein function: Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light. [The UniProt Consortium]
Keywords: Anti-RCV1, Anti-RCVRN, Anti-Recoverin, Anti-Protein CAR, Anti-Cancer-associated retinopathy protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41303

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human Recoverin. (within the following region: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQS)
MW: 23 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Recoverin"
Write a review
or to review a product.
Viewed