Anti-RECK / Reversion-inducing cysteine-rich protein with Kazal motifs

Anti-RECK / Reversion-inducing cysteine-rich protein with Kazal motifs
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4146 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RECK Antibody targets Reversion-inducing... more
Product information "Anti-RECK / Reversion-inducing cysteine-rich protein with Kazal motifs"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RECK Antibody targets Reversion-inducing cysteine-rich protein with Kazal motifs, a membrane-anchored regulatory protein encoded by the RECK gene that plays an important role in controlling extracellular matrix remodeling and protease activity. RECK is best known as a negative regulator of matrix metalloproteinases and functions as a suppressor of excessive proteolytic activity at the cell surface. Through this regulatory role, RECK contributes to maintenance of tissue architecture, cell-matrix interactions, and controlled cellular invasion.Functionally, Reversion-inducing cysteine-rich protein with Kazal motifs modulates the activity of multiple extracellular proteases involved in matrix degradation. By limiting proteolytic remodeling of the extracellular environment, RECK influences processes such as cell migration, adhesion, and tissue organization. A RECK Antibody enables investigation of extracellular matrix regulation, protease inhibition, and mechanisms that balance matrix stability with cellular dynamics in research settings.RECK expression is observed in a variety of tissues, with expression levels often associated with differentiated and non-invasive cellular phenotypes. At the cellular level, RECK is localized primarily to the plasma membrane, where it exerts regulatory control over pericellular protease activity. Because of this localization, changes in RECK expression or distribution may reflect alterations in cell-matrix communication, invasive potential, or tissue remodeling states.At the molecular level, RECK contains multiple cysteine-rich regions and Kazal-type motifs that are characteristic of protease inhibitor domains. These structural elements enable RECK to interact with and regulate extracellular proteases in a spatially restricted manner. The membrane-anchored nature of RECK allows it to function at the interface between the cell surface and the extracellular matrix, integrating protease regulation with cell signaling and adhesion processes.From a biological and disease relevance perspective, RECK has been extensively studied in cancer research, where reduced expression is frequently associated with increased invasiveness and tumor progression. Loss or downregulation of RECK expression has been linked to enhanced matrix degradation and metastatic potential in multiple tumor types. Conversely, maintained or elevated RECK expression is associated with suppression of invasive behavior, highlighting its role as a regulator of tumor microenvironment remodeling.RECK Antibody reagents are valuable tools for studying extracellular matrix regulation, protease control, and cell invasion mechanisms. These antibodies support research into tumor biology, tissue remodeling, and the molecular pathways that govern interactions between cells and their surrounding matrix. NSJ Bioreagents provides RECK Antibody products intended for research use.
Keywords: Anti-RECK, Anti-Suppressor of tumorigenicity 15 protein, Anti-Reversion-inducing cysteine-rich protein with Kazal motifs, RECK Antibody / Reversion-inducing cysteine-rich protein with Kazal motifs
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4146

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RECK / Reversion-inducing cysteine-rich protein with Kazal motifs"
Write a review
or to review a product.
Viewed