Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4146 | 100 µg | - | - |
7 - 12 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RECK Antibody targets Reversion-inducing... more
Product information "Anti-RECK / Reversion-inducing cysteine-rich protein with Kazal motifs"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RECK Antibody targets Reversion-inducing cysteine-rich protein with Kazal motifs, a membrane-anchored regulatory protein encoded by the RECK gene that plays an important role in controlling extracellular matrix remodeling and protease activity. RECK is best known as a negative regulator of matrix metalloproteinases and functions as a suppressor of excessive proteolytic activity at the cell surface. Through this regulatory role, RECK contributes to maintenance of tissue architecture, cell-matrix interactions, and controlled cellular invasion.Functionally, Reversion-inducing cysteine-rich protein with Kazal motifs modulates the activity of multiple extracellular proteases involved in matrix degradation. By limiting proteolytic remodeling of the extracellular environment, RECK influences processes such as cell migration, adhesion, and tissue organization. A RECK Antibody enables investigation of extracellular matrix regulation, protease inhibition, and mechanisms that balance matrix stability with cellular dynamics in research settings.RECK expression is observed in a variety of tissues, with expression levels often associated with differentiated and non-invasive cellular phenotypes. At the cellular level, RECK is localized primarily to the plasma membrane, where it exerts regulatory control over pericellular protease activity. Because of this localization, changes in RECK expression or distribution may reflect alterations in cell-matrix communication, invasive potential, or tissue remodeling states.At the molecular level, RECK contains multiple cysteine-rich regions and Kazal-type motifs that are characteristic of protease inhibitor domains. These structural elements enable RECK to interact with and regulate extracellular proteases in a spatially restricted manner. The membrane-anchored nature of RECK allows it to function at the interface between the cell surface and the extracellular matrix, integrating protease regulation with cell signaling and adhesion processes.From a biological and disease relevance perspective, RECK has been extensively studied in cancer research, where reduced expression is frequently associated with increased invasiveness and tumor progression. Loss or downregulation of RECK expression has been linked to enhanced matrix degradation and metastatic potential in multiple tumor types. Conversely, maintained or elevated RECK expression is associated with suppression of invasive behavior, highlighting its role as a regulator of tumor microenvironment remodeling.RECK Antibody reagents are valuable tools for studying extracellular matrix regulation, protease control, and cell invasion mechanisms. These antibodies support research into tumor biology, tissue remodeling, and the molecular pathways that govern interactions between cells and their surrounding matrix. NSJ Bioreagents provides RECK Antibody products intended for research use.
| Keywords: | Anti-RECK, Anti-Suppressor of tumorigenicity 15 protein, Anti-Reversion-inducing cysteine-rich protein with Kazal motifs, RECK Antibody / Reversion-inducing cysteine-rich protein with Kazal motifs |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4146 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA from the human protein |
| Format: | Purified |
Database Information
| KEGG ID : | K17461 | Matching products |
| UniProt ID : | O95980 | Matching products |
| Gene ID : | GeneID 8434 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed