Anti-RBMS1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41691.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Single-stranded DNA binding protein that interacts with the region upstream of... more

Close menu

Product information "Anti-RBMS1"

Protein function: Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication. [The UniProt Consortium]

Keywords:	Anti-RBMS1, Anti-C2orf12, Anti-Single-stranded DNA-binding protein MSSP-1, Anti-Suppressor of CDC2 with RNA-binding motif 2, Anti-RNA-binding motif, single-stranded-interacting protein 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41691

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: human, mouse, rat, cow, dog, goat, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the C-terminal region of Human RBMS1. (within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ)
MW:	45 kD
Format:	Purified