Anti-RanBP2 (C-Terminal Region)

Anti-RanBP2 (C-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32877 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RAN binding protein 2 (RANBP2), also... more
Product information "Anti-RanBP2 (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RAN binding protein 2 (RANBP2), also called NUP358 is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q. Protein function: E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single- stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PubMed:20386726). [The UniProt Consortium]
Keywords: Anti-p270, Anti-NUP358, Anti-RanBP2, Anti-RANBP2, EC=6.3.2.-, Anti-Nucleoporin Nup358, Anti-358 kDa nucleoporin, Anti-Ran-binding protein 2, Anti-E3 SUMO-protein ligase RanBP2, Anti-Nuclear pore complex protein Nup358, RanBP2 Antibody (C-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32877

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RanBP2 (C-Terminal Region)"
Write a review
or to review a product.
Viewed