Anti-RAB6A

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59020.50	50 µg		-	-	10 - 15 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Protein transport. Regulator of membrane traffic from the Golgi apparatus... more

Close menu

Product information "Anti-RAB6A"

Protein function: Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity. Involved in COPI-independent retrograde transport from the Golgi to the ER (PubMed:25962623). [The UniProt Consortium]

Keywords:	Anti-RAB6, Anti-Rab-6, Anti-RAB6A, Anti-Ras-related protein Rab-6A
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59020

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE)
MW:	23 kD
Format:	Antigen Affinity Purified