Anti-RAB1A

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG42601.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking,... more
Product information "Anti-RAB1A"
Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport. [The UniProt Consortium]
Keywords: Anti-RAB1, Anti-RAB1A, Anti-YPT1-related protein, Anti-Ras-related protein Rab-1A
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG42601

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse (Expected: cow, rat, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the center region of Human RAB1A. (within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC)
MW: 23 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RAB1A"
Write a review
or to review a product.
Viewed