Anti-RAB11A

Anti-RAB11A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32159 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-11A is a protein... more
Product information "Anti-RAB11A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.
Keywords: Anti-YL8, Anti-RAB11, Anti-Rab-11, Anti-RAB11A, Anti-Ras-related protein Rab-11A, RAB11A Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32159

Properties

Application: WB, IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ of human RAB11A were used as the immunogen for the RAB11 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RAB11A"
Write a review
or to review a product.
Viewed