Anti-PTS (6-pyruvoyl Tetrahydrobiopterin Synthase, PTP Synthase, PTPS, FLJ97081)

Anti-PTS (6-pyruvoyl Tetrahydrobiopterin Synthase, PTP Synthase, PTPS, FLJ97081)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132092.100 100 µg - -

3 - 19 business days*

943.00€
 
6-Pyruvoyltetrahydropterin synthase (PTS), also known as PTPS, belongs to the family of lyases,... more
Product information "Anti-PTS (6-pyruvoyl Tetrahydrobiopterin Synthase, PTP Synthase, PTPS, FLJ97081)"
6-Pyruvoyltetrahydropterin synthase (PTS), also known as PTPS, belongs to the family of lyases, specifically those carbon-oxygen lyases acting on phosphates. The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 132092

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PTS (6-pyruvoyl Tetrahydrobiopterin Synthase, PTP Synthase, PTPS, FLJ97081)"
Write a review
or to review a product.
Viewed