Anti-PTP4A2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59224.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Protein tyrosine phosphatase which stimulates progression from G1 into S phase... more

Close menu

Product information "Anti-PTP4A2"

Protein function: Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. [The UniProt Consortium]

Keywords:	Anti-OV-1, Anti-PRL2, Anti-PRL-2, Anti-BM-008, Anti-PTP4A2, Anti-HU-PP-1, EC=3.1.3.48, Anti-PTP(CAAXII), Anti-Protein-tyrosine phosphatase 4a2, Anti-Protein tyrosine phosphatase type IVA 2, Anti-Protein-tyrosine phosphatase of regenerating liver 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59224

Properties

Application:	FC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: hamster)
Immunogen:	Synthetic peptide corresponding to aa. 40-69 of Human PTP4A2. (TTLVRVCDATYDKAPVEKEGIHVLDWPFDD)
MW:	19 kD
Format:	Antigen Affinity Purified