Anti-Prolactin Receptor / PRLR

Anti-Prolactin Receptor / PRLR
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31984 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRLR (Prolactin Receptor) is a cytokine... more
Product information "Anti-Prolactin Receptor / PRLR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands. Protein function: This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling. [The UniProt Consortium]
Keywords: Anti-PRLR, Anti-PRL-R, Anti-Prolactin receptor, Prolactin Receptor Antibody / PRLR
Supplier: NSJ Bioreagents
Supplier-Nr: R31984

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ of human PRLR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Prolactin Receptor / PRLR"
Write a review
or to review a product.
Viewed