Anti-PRKAG2 (5'-AMP-activated Protein Kinase Subunit gamma-2, AMPK gamma2, AMPK Subunit gamma-2, H91

Anti-PRKAG2 (5'-AMP-activated Protein Kinase Subunit gamma-2, AMPK gamma2, AMPK Subunit gamma-2, H91
Item number Size Datasheet Manual SDS Delivery time Quantity Price
131792.100 100 µg - -

3 - 19 business days*

850.00€
 
AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase... more
Product information "Anti-PRKAG2 (5'-AMP-activated Protein Kinase Subunit gamma-2, AMPK gamma2, AMPK Subunit gamma-2, H91"
AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton, probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: AFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 131792

Properties

Application: ELISA, IF
Antibody Type: Monoclonal
Clone: 3C4
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PRKAG2 (5'-AMP-activated Protein Kinase Subunit gamma-2, AMPK gamma2, AMPK Subunit gamma-2, H91"
Write a review
or to review a product.
Viewed