Anti-PREB

Anti-PREB
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59245.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: Guanine nucleotide exchange factor that specifically activates the small GTPase... more
Product information "Anti-PREB"
Protein function: Guanine nucleotide exchange factor that specifically activates the small GTPase SAR1B. Mediates the recruitement of SAR1B and other COPII coat components to endoplasmic reticulum membranes and is therefore required for the formation of COPII transport vesicles from the ER. [The UniProt Consortium]
Keywords: Anti-Preb, Anti-Sec12, Anti-Prolactin regulatory element-binding protein, Anti-Mammalian guanine nucleotide exchange factor mSec12
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59245

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse (Expected: human, rat, bovine, dog, guinea pig, horse, swine, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Mouse PREB. (within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL)
MW: 45 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PREB"
Write a review
or to review a product.
Viewed