Anti-POR / CYPOR / Cytochrome P450 Oxidoreductase

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31983 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. POR is a membrane-bound enzyme required... more
Product information "Anti-POR / CYPOR / Cytochrome P450 Oxidoreductase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. POR is a membrane-bound enzyme required for electron transfer from NADPH to Cytochrome p450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal p450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined p450C17 and p450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Protein function: This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5. [The UniProt Consortium]
Keywords: Anti-CPR, Anti-CYPOR, Anti-P450R, Anti-NADPH--cytochrome P450 reductase, POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase
Supplier: NSJ Bioreagents
Supplier-Nr: R31983

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK of human Cytochrome P450 Oxidoreductase were used as the immunogen for the POR antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-POR / CYPOR / Cytochrome P450 Oxidoreductase"
Write a review
or to review a product.
Viewed