Anti-POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-direct

Anti-POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-direct
Item number Size Datasheet Manual SDS Delivery time Quantity Price
131598.100 100 µg - -

3 - 19 business days*

850.00€
 
POLR3D is a DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the... more
Product information "Anti-POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-direct"
POLR3D is a DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 131598

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 4E6
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-direct"
Write a review
or to review a product.
Viewed