Anti-POLI / DNA Polymerase Iota

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59302.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Error-prone DNA polymerase specifically involved in DNA repair. Plays an... more
Product information "Anti-POLI / DNA Polymerase Iota"
Protein function: Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity. [The UniProt Consortium]
Keywords: Anti-Eta2, Anti-POLI, Anti-RAD30B, EC=2.7.7.7, Anti-RAD30 homolog B, Anti-DNA polymerase iota
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59302

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human POLI / DNA Polymerase Iota. (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK)
MW: 83 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-POLI / DNA Polymerase Iota"
Write a review
or to review a product.
Viewed