Anti-PMEL17 / Melanoma gp100

Anti-PMEL17 / Melanoma gp100
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4546 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is mapped to 12q13.2. It encodes... more
Product information "Anti-PMEL17 / Melanoma gp100"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants. Protein function: Plays a central role in the biogenesis of melanosomes. Involved in the maturation of melanosomes from stage I to II. The transition from stage I melanosomes to stage II melanosomes involves an elongation of the vesicle, and the appearance within of distinct fibrillar structures. Release of the soluble form, ME20-S, could protect tumor cells from antibody mediated immunity. [The UniProt Consortium]
Keywords: Anti-PMEL, Anti-D12S53E, PMEL17 / Melanoma gp100 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4546

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PMEL17 / Melanoma gp100"
Write a review
or to review a product.
Viewed