Anti-PKLR

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32061 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pyruvate kinase isozymes R/L is an enzyme... more
Product information "Anti-PKLR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Pyruvate kinase that catalyzes the conversion of phosphoenolpyruvate to pyruvate with the synthesis of ATP, and which plays a key role in glycolysis. [The UniProt Consortium]
Keywords: Anti-PK1, Anti-PKLR, Anti-Pyruvate kinase 1, Anti-Pyruvate kinase PKLR, Anti-Pyruvate kinase isozymes L/R, Anti-R-type/L-type pyruvate kinase, Anti-Red cell/liver pyruvate kinase, PKLR Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32061

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EAIWADDVDRRVQFGIESGKLRGFLRVGDLV of human PKLR
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PKLR"
Write a review
or to review a product.
Viewed