Anti-PITX2

Anti-PITX2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5602 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Paired-like homeodomain transcription... more
Product information "Anti-PITX2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Paired-like homeodomain transcription factor 2 also known as pituitary homeobox 2 is a protein that in humans is encoded by the PITX2 gene. It is mapped to 4q25. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described. Protein function: Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform PTX2C is involved in left-right asymmetry the developing embryo. [The UniProt Consortium]
Keywords: Anti-ARP1, Anti-Solurshin, Anti-Pituitary homeobox 2, Anti-Homeobox protein PITX2, Anti-ALL1-responsive protein ARP1, Anti-Paired-like homeodomain transcription factor 2, Anti-RIEG bicoid-related homeobox transcription factor, PITX2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5602

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PITX2"
Write a review
or to review a product.
Viewed