Anti-PIGR / Polymeric immunoglobulin receptor

Anti-PIGR / Polymeric immunoglobulin receptor
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31866 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PIGR antibody targets Polymeric... more
Product information "Anti-PIGR / Polymeric immunoglobulin receptor"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PIGR antibody targets Polymeric immunoglobulin receptor, encoded by the PIGR gene. Polymeric immunoglobulin receptor is a transmembrane glycoprotein that plays a central role in mucosal immunity by mediating the transcytosis of polymeric immunoglobulins across epithelial cells. PIGR binds dimeric IgA and pentameric IgM at the basolateral surface of epithelial cells and transports these antibodies to the apical surface, where they are released into mucosal secretions. This process is essential for immune defense at mucosal barriers such as the gastrointestinal, respiratory, and genitourinary tracts.Functionally, Polymeric immunoglobulin receptor enables the delivery of secretory antibodies that neutralize pathogens and toxins at mucosal surfaces. During transcytosis, PIGR is proteolytically cleaved to release the extracellular secretory component, which remains associated with IgA to form secretory IgA. The secretory component enhances antibody stability and protects immunoglobulins from proteolytic degradation in harsh mucosal environments. A PIGR antibody supports studies focused on epithelial transport mechanisms and mucosal immune defense.PIGR expression is predominantly observed in epithelial cells lining mucosal tissues, including intestinal epithelium, airway epithelium, salivary glands, mammary glands, and hepatobiliary epithelium. Expression is regulated by inflammatory cytokines and microbial stimuli, allowing epithelial cells to adjust immunoglobulin transport capacity in response to immune challenge. This inducible expression pattern highlights the role of PIGR as a dynamic interface between epithelial barriers and the immune system.From a disease-relevance perspective, altered PIGR expression has been associated with inflammatory and infectious diseases of mucosal tissues. Reduced PIGR expression has been linked to impaired mucosal immunity and increased susceptibility to infection, while dysregulated expression has been reported in chronic inflammatory conditions such as inflammatory bowel disease. PIGR has also been studied in cancer biology, particularly in gastrointestinal and hepatocellular carcinomas, where changes in epithelial differentiation and immune interactions can influence receptor expression. These associations make PIGR an important target in studies of barrier function and immune-epithelial crosstalk.At the molecular level, Polymeric immunoglobulin receptor contains multiple extracellular immunoglobulin-like domains, a single transmembrane region, and a short cytoplasmic tail that directs intracellular trafficking. Post-translational modifications, proteolytic cleavage, and glycosylation contribute to isoform diversity and variable electrophoretic behavior on SDS-PAGE. A PIGR antibody supports research applications focused on mucosal immunology, epithelial biology, and disease-associated changes in antibody transport, with NSJ Bioreagents providing reagents intended for research use.
Keywords: Anti-PIGR, Anti-Polymeric immunoglobulin receptor, Anti-Hepatocellular carcinoma-associated protein TB6, PIGR Antibody / Polymeric immunoglobulin receptor
Supplier: NSJ Bioreagents
Supplier-Nr: R31866

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD of human PIGR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PIGR / Polymeric immunoglobulin receptor"
Write a review
or to review a product.
Viewed