Anti-PIGR

Anti-PIGR
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31866 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Polymeric immunoglobulin receptor is a... more
Product information "Anti-PIGR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells, the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene. Protein function: This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment. [The UniProt Consortium]
Keywords: Anti-PIGR, PIGR Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31866

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD of human PIGR were used as the immunogen for the PIGR antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PIGR"
Write a review
or to review a product.
Viewed