Anti-PIAS4

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59326.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase,... more

Close menu

Product information "Anti-PIAS4"

Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. [The UniProt Consortium]

Keywords:	Anti-PIAS4, Anti-PIASy, Anti-PIASG, Anti-PIAS-gamma, Anti-E3 SUMO-protein ligase PIAS4, Anti-RING-type E3 ubiquitin transferase PIAS4, Anti-Protein inhibitor of activated STAT protein 4, Anti-Protein inhibitor of activated STAT protein gamma
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59326

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: bovine, dog, horse, monkey)
Immunogen:	Synthetic peptide corresponding to aa. 130-174 of Human PIAS4. (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE)
MW:	57 kD
Format:	Antigen Affinity Purified