Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG59326.50 | 50 µg | - | - |
6 - 14 business days* |
551.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase,... more
Product information "Anti-PIAS4"
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. [The UniProt Consortium]
| Keywords: | Anti-PIAS4, Anti-PIASy, Anti-PIASG, Anti-PIAS-gamma, Anti-E3 SUMO-protein ligase PIAS4, Anti-RING-type E3 ubiquitin transferase PIAS4, Anti-Protein inhibitor of activated STAT protein 4, Anti-Protein inhibitor of activated STAT protein gamma |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG59326 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat (Expected: bovine, dog, horse, monkey) |
| Immunogen: | Synthetic peptide corresponding to aa. 130-174 of Human PIAS4. (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) |
| MW: | 57 kD |
| Format: | Antigen Affinity Purified |
Database Information
| KEGG ID : | K16065 | Matching products |
| UniProt ID : | Q8N2W9 | Matching products |
| Gene ID : | GeneID 51588 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed